1.67 Rating by CuteStat

payperclickadvertisingservices.info is 8 years 10 months old. It is a domain having info extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, payperclickadvertisingservices.info is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.168.221.96

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
Welcome to PAYPERCLICKADVERTISINGSERVICES.INFO

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 5
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 184.168.221.96)

Welcome to TRYNOW4FREE.COM

- trynow4free.com
Not Applicable $ 8.95

Welcome to TRUTHSOLAR.COM

- truthsolar.com
Not Applicable $ 8.95

Welcome to TOUGHWATERWARS.COM

- toughwaterwars.com
Not Applicable $ 8.95

Welcome to TOUGH-WATER.COM

- tough-water.com
Not Applicable $ 8.95

Welcome to TOPSEOSEM.COM

- topseosem.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Wed, 01 Jul 2015 09:02:37 GMT
Content-Length: 3463
Age: 0
Connection: keep-alive

Domain Information

Domain Registrar: Nimzo 38, LLC
Registration Date: Jun 25, 2015, 12:00 AM 8 years 10 months 2 weeks ago
Domain Status:
serverTransferProhibited
Owner's E-Mail: usmankhanlucky@gmail.com

Domain Nameserver Information

Host IP Address Country
ns01.cashparking.com 97.74.107.38 United States of America United States of America
ns02.cashparking.com 173.201.75.38 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
payperclickadvertisingservices.info A 599 IP: 184.168.221.96
payperclickadvertisingservices.info NS 3599 Target: ns01.cashparking.com
payperclickadvertisingservices.info SOA 3599 MNAME: ns01.cashparking.com
RNAME: dns.jomax.net
Serial: 2012100100
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 86400
payperclickadvertisingservices.info MX 3599 Target: smtp.secureserver.net
payperclickadvertisingservices.info MX 3599 Priority: 10
Target: mailstore1.secureserver.net

Full WHOIS Lookup

Domain Name:PAYPERCLICKADVERTISINGSERVICES.INFO
Domain ID: D55291659-LRMS
Creation Date: 2015-06-25T18:35:48Z
Updated Date: 2015-06-26T03:15:28Z
Registry Expiry Date: 2016-06-25T18:35:48Z
Sponsoring Registrar:1&1 Internet AG (R113-LRMS)
Sponsoring Registrar IANA ID: 83
WHOIS Server:
Referral URL:
Domain Status: serverTransferProhibited -- http://www.icann.org/epp#serverTransferProhibited
Registrant ID:SPAG-50540743
Registrant Name:Ubaid Javed
Registrant Organization:Shaheen
Registrant Street: House # 30 Mohallah Qadir abad
Registrant City:Multan
Registrant State/Province:PB
Registrant Postal Code:59050
Registrant Country:PK
Registrant Phone:+92.3328542427
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:usmankhanlucky@gmail.com
Admin ID:SPAG-50696402
Admin Name:Ubaid Javed
Admin Organization:Shaheen
Admin Street: House # 30 Mohallah Qadir abad
Admin City:Multan
Admin State/Province:PB
Admin Postal Code:59050
Admin Country:PK
Admin Phone:+92.3328542427
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:usmankhanlucky@gmail.com
Billing ID:C3594293-LRMS
Billing Name:Hostmaster ONEANDONE
Billing Organization:1&1 Internet Inc.
Billing Street: 701 Lee Rd.
Billing Street: Suite 300
Billing City:Chesterbrook
Billing State/Province:PA
Billing Postal Code:19087
Billing Country:US
Billing Phone:+1.8774612631
Billing Phone Ext:
Billing Fax: +1.6105601501
Billing Fax Ext:
Billing Email:hostmaster@1and1.com
Tech ID:C3594293-LRMS
Tech Name:Hostmaster ONEANDONE
Tech Organization:1&1 Internet Inc.
Tech Street: 701 Lee Rd.
Tech Street: Suite 300
Tech City:Chesterbrook
Tech State/Province:PA
Tech Postal Code:19087
Tech Country:US
Tech Phone:+1.8774612631
Tech Phone Ext:
Tech Fax: +1.6105601501
Tech Fax Ext:
Tech Email:hostmaster@1and1.com
Name Server:NS01.CASHPARKING.COM
Name Server:NS02.CASHPARKING.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Access to AFILIAS WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Afilias registry database. The data in this record is provided by Afilias Limited for informational purposes only, and Afilias does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Afilias reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.