Web Analysis for Payperclickadvertisingservices - payperclickadvertisingservices.info
1.67
Rating by CuteStat
payperclickadvertisingservices.info is 8 years 10 months old. It is a domain having info extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, payperclickadvertisingservices.info is SAFE to browse.
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 5 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 184.168.221.96)
HTTP Header Analysis
HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Wed, 01 Jul 2015 09:02:37 GMT
Content-Length: 3463
Age: 0
Connection: keep-alive
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Wed, 01 Jul 2015 09:02:37 GMT
Content-Length: 3463
Age: 0
Connection: keep-alive
Domain Information
Domain Registrar: | Nimzo 38, LLC |
---|---|
Registration Date: | Jun 25, 2015, 12:00 AM 8 years 10 months 2 weeks ago |
Domain Status: |
serverTransferProhibited
|
Owner's E-Mail: | usmankhanlucky@gmail.com |
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns01.cashparking.com | 97.74.107.38 | United States of America | |
ns02.cashparking.com | 173.201.75.38 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
payperclickadvertisingservices.info | A | 599 |
IP: 184.168.221.96 |
payperclickadvertisingservices.info | NS | 3599 |
Target: ns01.cashparking.com |
payperclickadvertisingservices.info | SOA | 3599 |
MNAME: ns01.cashparking.com RNAME: dns.jomax.net Serial: 2012100100 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 86400 |
payperclickadvertisingservices.info | MX | 3599 |
Target: smtp.secureserver.net |
payperclickadvertisingservices.info | MX | 3599 |
Priority: 10 Target: mailstore1.secureserver.net |
Full WHOIS Lookup
Domain Name:PAYPERCLICKADVERTISINGSERVICES.INFO
Domain ID: D55291659-LRMS
Creation Date: 2015-06-25T18:35:48Z
Updated Date: 2015-06-26T03:15:28Z
Registry Expiry Date: 2016-06-25T18:35:48Z
Sponsoring Registrar:1&1 Internet AG (R113-LRMS)
Sponsoring Registrar IANA ID: 83
WHOIS Server:
Referral URL:
Domain Status: serverTransferProhibited -- http://www.icann.org/epp#serverTransferProhibited
Registrant ID:SPAG-50540743
Registrant Name:Ubaid Javed
Registrant Organization:Shaheen
Registrant Street: House # 30 Mohallah Qadir abad
Registrant City:Multan
Registrant State/Province:PB
Registrant Postal Code:59050
Registrant Country:PK
Registrant Phone:+92.3328542427
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:usmankhanlucky@gmail.com
Admin ID:SPAG-50696402
Admin Name:Ubaid Javed
Admin Organization:Shaheen
Admin Street: House # 30 Mohallah Qadir abad
Admin City:Multan
Admin State/Province:PB
Admin Postal Code:59050
Admin Country:PK
Admin Phone:+92.3328542427
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:usmankhanlucky@gmail.com
Billing ID:C3594293-LRMS
Billing Name:Hostmaster ONEANDONE
Billing Organization:1&1 Internet Inc.
Billing Street: 701 Lee Rd.
Billing Street: Suite 300
Billing City:Chesterbrook
Billing State/Province:PA
Billing Postal Code:19087
Billing Country:US
Billing Phone:+1.8774612631
Billing Phone Ext:
Billing Fax: +1.6105601501
Billing Fax Ext:
Billing Email:hostmaster@1and1.com
Tech ID:C3594293-LRMS
Tech Name:Hostmaster ONEANDONE
Tech Organization:1&1 Internet Inc.
Tech Street: 701 Lee Rd.
Tech Street: Suite 300
Tech City:Chesterbrook
Tech State/Province:PA
Tech Postal Code:19087
Tech Country:US
Tech Phone:+1.8774612631
Tech Phone Ext:
Tech Fax: +1.6105601501
Tech Fax Ext:
Tech Email:hostmaster@1and1.com
Name Server:NS01.CASHPARKING.COM
Name Server:NS02.CASHPARKING.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned
Access to AFILIAS WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Afilias registry database. The data in this record is provided by Afilias Limited for informational purposes only, and Afilias does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Afilias reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.
Domain ID: D55291659-LRMS
Creation Date: 2015-06-25T18:35:48Z
Updated Date: 2015-06-26T03:15:28Z
Registry Expiry Date: 2016-06-25T18:35:48Z
Sponsoring Registrar:1&1 Internet AG (R113-LRMS)
Sponsoring Registrar IANA ID: 83
WHOIS Server:
Referral URL:
Domain Status: serverTransferProhibited -- http://www.icann.org/epp#serverTransferProhibited
Registrant ID:SPAG-50540743
Registrant Name:Ubaid Javed
Registrant Organization:Shaheen
Registrant Street: House # 30 Mohallah Qadir abad
Registrant City:Multan
Registrant State/Province:PB
Registrant Postal Code:59050
Registrant Country:PK
Registrant Phone:+92.3328542427
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:usmankhanlucky@gmail.com
Admin ID:SPAG-50696402
Admin Name:Ubaid Javed
Admin Organization:Shaheen
Admin Street: House # 30 Mohallah Qadir abad
Admin City:Multan
Admin State/Province:PB
Admin Postal Code:59050
Admin Country:PK
Admin Phone:+92.3328542427
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:usmankhanlucky@gmail.com
Billing ID:C3594293-LRMS
Billing Name:Hostmaster ONEANDONE
Billing Organization:1&1 Internet Inc.
Billing Street: 701 Lee Rd.
Billing Street: Suite 300
Billing City:Chesterbrook
Billing State/Province:PA
Billing Postal Code:19087
Billing Country:US
Billing Phone:+1.8774612631
Billing Phone Ext:
Billing Fax: +1.6105601501
Billing Fax Ext:
Billing Email:hostmaster@1and1.com
Tech ID:C3594293-LRMS
Tech Name:Hostmaster ONEANDONE
Tech Organization:1&1 Internet Inc.
Tech Street: 701 Lee Rd.
Tech Street: Suite 300
Tech City:Chesterbrook
Tech State/Province:PA
Tech Postal Code:19087
Tech Country:US
Tech Phone:+1.8774612631
Tech Phone Ext:
Tech Fax: +1.6105601501
Tech Fax Ext:
Tech Email:hostmaster@1and1.com
Name Server:NS01.CASHPARKING.COM
Name Server:NS02.CASHPARKING.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned
Access to AFILIAS WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Afilias registry database. The data in this record is provided by Afilias Limited for informational purposes only, and Afilias does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Afilias reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.